PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G21880.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 511aa    MW: 56296.8 Da    PI: 4.5891
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G21880.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-1878125148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++l ++v+ +G g+W+++ r  g++R++k+c++rw ++l
  ORUFI06G21880.4  78 KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL 125
                      79******************************************9986 PP

2Myb_DNA-binding42.21.9e-13131174146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+e +++++  lG++ W++ a+ ++ gRt++++k++w++
  ORUFI06G21880.4 131 KGPFSKEEEEMIIKLHLWLGNK-WAKMANSLP-GRTDNEIKNFWNT 174
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.63973129IPR017930Myb domain
SuperFamilySSF466892.73E-3075172IPR009057Homeodomain-like
SMARTSM007175.2E-1677127IPR001005SANT/Myb domain
PfamPF002494.3E-1778125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2479132IPR009057Homeodomain-like
CDDcd001674.59E-1280125No hitNo description
SMARTSM007171.9E-12130178IPR001005SANT/Myb domain
PROSITE profilePS5129416.24130180IPR017930Myb domain
PfamPF002494.0E-12131174IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-24133178IPR009057Homeodomain-like
CDDcd001671.31E-9133174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MEGSSPMEEE EEAARLAGSQ GESPAMLHPN GDGDGDGGDD EGDASGGEEE QGGVARAGVR  60
RRGGGGRVRV RGRIPLKKGP WTPDEDKRLR EYVEAHGEGN WNRVQRNAGL NRCGKSCRLR  120
WANHLKPDLK KGPFSKEEEE MIIKLHLWLG NKWAKMANSL PGRTDNEIKN FWNTRCKRIQ  180
RTGEPLYPKE FNHFKLTDLE VMNCESPDES RAKKRTNEVL QGNGQSYKEV FFDNLDYSRP  240
ENYIRPNCVT PNSLPVDATS PFGSAIATQD QSVPFGSAIV SGHPILDGNF STSGTIQRPM  300
NVELPSLQYP NYDFNNNNAW SYHDPLGHPI DQVDFGSLRS EYLSPNNNGL LDALVHGGHG  360
QGELANSQGS FDACFPRVQC NQVIQSNAFS LSSSFPIIGD DLLENSCHAF VGINNNASSL  420
FLDSQPPPLV DPTFWRHDVS LEPNLPVYCQ FNEELPPSNE QFAKDADDAF GHGGLSDETN  480
LAAAGQGDEH DLEDPWASMP GACDIPDFPS E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27761785106B-MYB
1h8a_C2e-277617825126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2120750.0AB212075.1 Oryza sativa Japonica Group mRNA for GAMYB-like1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641123.10.0PREDICTED: transcription factor GAMYB
TrEMBLI1Q3H60.0I1Q3H6_ORYGL; Uncharacterized protein
STRINGORGLA06G0168900.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-55myb domain protein 101